PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011546P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 274aa    MW: 30410.9 Da    PI: 5.7222
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011546P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.66.6e-29208258151
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                     k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQ
  MELO3C011546P1 208 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ 258
                     79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.946205265IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-24205258IPR009057Homeodomain-like
SuperFamilySSF466894.12E-14206259IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-24208259IPR006447Myb domain, plants
PfamPF002493.3E-6210258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MVYSDKMQEI AAKMGFTLSD FADTLEQERR KVLMFQRELP LCLQLVSHAI DCCRQQLSGT  60
TTENRQSECS EQTSSDIGPV LEEFIPINRN GVSDFEKTEK INKNDDPDLN NLNLAPSDWL  120
RSAQLWNQTS DPPPLNQDLP ENTPVVEVNR NGGAFRPFQK EKTGGCGGGG GASSSSPPAP  180
AAETSSTTET GSGGSSRREE KEAQNQRKQR RCWSPELHRR FLHALQQLGG SHVATPKQIR  240
ELMKVDGLTN DEVKSHLQVC SFSFSFFFFS KLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818171e-160LN681817.1 Cucumis melo genomic scaffold, anchoredscaffold00015.
GenBankLN7132571e-160LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445641.10.0PREDICTED: probable transcription factor GLK2
TrEMBLA0A0A0KAT41e-169A0A0A0KAT4_CUCSA; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-69G2-like family protein